PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000157940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 287aa    MW: 32327.9 Da    PI: 8.4884
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000157940genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+  Ed ll ++++ +G g+W++ +++ g+ R++k+c++rw +yl
    MDP0000157940 14 RGPWSNREDTLLTQYIEAHGEGQWRSLPEKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding51.81.8e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T +Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000157940  67 RGNITSDEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.654961IPR017930Myb domain
SuperFamilySSF466891.17E-2811108IPR009057Homeodomain-like
SMARTSM007172.5E-121363IPR001005SANT/Myb domain
PfamPF002491.9E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-221568IPR009057Homeodomain-like
CDDcd001679.05E-91661No hitNo description
PROSITE profilePS5129425.92862116IPR017930Myb domain
SMARTSM007171.3E-1566114IPR001005SANT/Myb domain
PfamPF002491.1E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2669116IPR009057Homeodomain-like
CDDcd001675.08E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRXPCCSKV GLNRGPWSNR EDTLLTQYIE AHGEGQWRSL PEKAGLLRCG KSCRLRWMNY  60
LKPDIKRGNI TSDEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKRLIXEG  120
TDPNTHKKLS EPIAKENKRR ENQSCKNRNN KKEMVKTMMK SKTKTGQHVE PQKPKVHLPK  180
PTRITSFLSL PRNDSFTSST TVTTASSIQD LNGGGGGAFG VNPWCNNGVV LCVGDPDQDP  240
INSSADGGDD HSLENLYEEY LQALLTDHHH DHQNQLELDS FAESLLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25121165108B-MYB
1h8a_C3e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.236550.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9097590.0KJ909759.1 Malus domestica MYBPA1-like transcription factor (MYBPA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008352872.10.0PREDICTED: myb-related protein 308-like
SwissprotP813939e-68MYB08_ANTMA; Myb-related protein 308
TrEMBLH6S3731e-158H6S373_PRUAV; R2R3-MYB transcription factor
STRINGPOPTR_0002s17460.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.14e-68myb domain protein 3